This document provides instructions for .
You need not bother reading this document unless you are administering a server running the ProteinProspector programs.
- Introduction
- Background on FASTA format
- Using other programs with the same FASTA database files
- ProteinProspector database filenaming conventions
- FA-Index output files (the indices)
- Ignore/bypass the indicies?
- The Browser Version of FA-Index
- Creating Indicies for a New Database
- Updating the Database and Species Lists in the HTML Forms
- Creating a Pre-Search Subset Database
- Creating a Subset Database with Indices from Saved Hits
- Creating or Appending to a Database Containing User Supplied Protein or DNA Sequences
- Database Summary Report
- The Command Line Version of FA-Index
- Saving Hits from one ProteinProspector program, searching them with another
- Databases
- Species Filtering
- Accession Number Filtering
- Species Code Filtering
- Intact Protein MW Filtering
- Intact Protein pI Filtering
FA-Index was developed for five main reasons:
- To enable an internal means for the ProteinProspector programs to store an index number when a hit is recorded during a search, then later use that number to retrieve that database entry for output/report generation purposes. This cuts down the memory requirements for program execution.
- To provide indices which can be used to accelerate searches that are pre-filtered by intact protein MW, protein pI and/or species.
- To aid the ProteinProspector programs in addressing some of the hindrances inherent in FASTA comment line format heterogeneity.
- To allow users to create subset databases based on either a Species/Protein MW pre-filter or the results of a previous search. Searches performed on these smaller databases are often very much faster than searches performed on complete databases.
- To allow users to create databases containing user defined proteins.
The FASTA format for sequence databases was originally developed by Pearson for use with the FASTA program. Today it is probably the most widely used standard format, primarily because its brevity results in the smallest possible file size for sequences.
An example of the format is shown below:
>sp|P28190|AA1R_BOVIN ADENOSINE A1 RECEPTOR.
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPRTYFHTCLKVACPVLILTQSSILALLAMAVDRYLRVKIPLRYKTVVT
PRRAVVAITGCWILSFVVGLTPMFGWNNLSAVERDWLANGSVGEPVIECQFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYMEVFYLIRKQLSKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHMPRILIYIAIFLSHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDAPAERPDD
As a standard it leaves something to be desired, because the "standard" is that there is a single comment line per entry which must begin with the ">" character and all subsequent lines for an entry contain sequence. However, there are many "standards" as to the arrangement of fields and/or de-limiting of fields in the comment line. Often the comment line is used to describe basic information like entry name, accession number (or other unique identifier), and the species or organism from which the sequence was obtained.
The FASTA format was chosen for use with ProteinProspector primarily because of it's universality, brevity, and expected ease with which database files could be shared on the same computer with other programs for sequence analysis.
The FA-Index program creates several indices which are much smaller files than the FASTA database file. These indices aid the ProteinProspector programs in addressing some of the hindrances inherent in the FASTA comment line format heterogeneity.
There is no reason that we know of that should prevent use of the FASTA database files by both ProteinProspector programs and other programs which accept FASTA format. Further, we believe it should be possible for the files to be simultaneously read by more than one program at a time. It may be of interest to some users that the SEQUEST program from John Yates' group at the University of Washington also uses FASTA formatted databases.
Often the comment line in a FASTA database is used to describe basic information like entry name, accession number (or other unique identifier), and the species or organism from which the sequence was obtained. However, this information is NOT consistently organized into fields in the comment line of different FASTA database, though within a specific database it is sometimes consistent.
The way ProteinProspector programs "know" which dialect of FASTA to "speak" with a particular database is via the filename. Acceptable filename prefixes are shown below in bold and the associated comment line format described.
Sample entries:
ProteinProspector programs designate:
- accession number, 216790 in the first example, as the number after the first | in the line. This can be delimited by a | or a space.
- species, Mycoplasma hominis in the first example, as the string between the last set of square brackets in the line.
- name, arginine deiminase in the first example, as the string between the first space and the last "[" in the line.
Some entries cause problems:
Previously the accession number was taken to be number between the first set of round brackets in the line. However entries like the one above don't have this field. This entry also doesn't contain a species field.
Whenever the species cannot be found the species is assigned as UNREADABLE, and the name is assigned as the entire comment line. All of these UNREADABLE lines are then written by FA-Index to the file seqdb/Genpept....usp.
Some other entries are also potentially problematic.
This entry is very long and has been truncated by a > character.
Neither of the following contain easily extractable species.
This entry doesn't have anything in the name field but the species is OK.
The previously used accession number in the round brackets for these two entries are identical.
This entry contain a zone delimited by [ ] characters which is not at the end of the line and doesn't contain a species.
This database should now be downloaded from NCBI and the comment line format has changed. The entries come from four different sources:
ProteinProspector programs designate:
- accession number, 100K_RAT as the string between the second | and the first space in the line.
- species, RAT, as the characters after the underscore in the accession number.
- name: 100 KD PROTEIN (EC 6.3.2.-). as the string between the first space and the last dash " -" in the line.
ProteinProspector programs designate:
- accession number, B40638 as the string between the second | and the first space in the line.
- species, Rhodobacter sphaeroides, as the text string following the last space-dash-space (" - ") in the line.
- name: isocytochrome c2 as the string between the first space and the last dash " -" in the line.
ProteinProspector programs designate:
- accession number, A7120FTSZ1 as the string between the second | and the first space in the line.
- species, Anabaena PCC7120. as the text string following the last space-dash-space (" - ") in the line. Note that there is a full stop after the species which must be deleted.
- name: A7120FTSZ NID: g1100793 as the string between the first space and the last dash " -" in the line.
ProteinProspector programs designate:
- accession number, NRL_1A00B as the string between the second | and the first space in the line.
- species, human. as the text string following the last space-dash-space (" - ") in the line.
- name: hemoglobin beta chain mutant (V1M, W37Y) (deoxy), chain B as the string between the first space and the last dash " -" in the line.
Whenever the species cannot be found the species is assigned as UNREADABLE, and the name is assigned as the entire comment line. All of these UNREADABLE lines are then written by FA-Index to the file seqdb/Owl....usp.
A typical comment line causing problems is:
There are three full stops at the end of the line.
Previously the comment lines had the following format:
Sample entry as output by the sp2fasta program:
Sample entry if the database is downloaded from NCBI:
ProteinProspector programs designate:
- accession number, P16105 the alphanumeric string between the first sp| and the next | in the comment line
- species, BOVIN, as the string between the underscore and the space in the next field.
- name: HISTONE H3 (H3.2), as the string following the species
Whenever the species cannot be found the species is assigned as UNREADABLE, and the name is assigned as the entire comment line (this usually does not happen for any entries in SwissProt). All of these UNREADABLE lines are then written by FA-Index to the file seqdb/SwissProt....usp.
A few entries are of the following form:
In these cases the accession number is taken as being the first number ie. 400027 for the example shown.
The species is extracted from the code between the last vertical bar and the first space. It appears after the first underscore and before the second underscore (if present). The name is the rest of the line.
Another format used is:
ProteinProspector programs designate:
- species, THEPA, as the string between the underscore and the space in the second field.
- accession number, P15711 as the alphanumeric string before the first |
- name: 104 kDa microneme-rhoptry antigen precursor (p104), as the string between the first space and the last dash "-" in the line.
Sample entries:
ProteinProspector programs designate:
- species, THEPA, as the string between the underscore and the space in the first field.
- accession number, P15711 as the alphanumeric string in the brackets following the first field
- name: 104 kDa microneme-rhoptry antigen, as the string following the accession number field
ProteinProspector programs designate:
- species, THEPA, as the string between the underscore and the space in the second field.
- accession number, P15711 as the alphanumeric string before the first |
- name: 104 kDa microneme-rhoptry antigen precursor (p104), as the string between the first space and the last dash "-" in the line.
Sample entries:
ProteinProspector programs designate:
- accession number, IPI00177321.1 as the alphanumeric string between the first colon and the first vertical bar
- species, as UNREADABLE.
- name: similar to NOD3 protein, as the string following the second space in the line
The comment lines from this database are tricky to handle because it is a non-redundant database which collects entries form several databases, thus there are several formats present in the final database.
Further information is available from the NCBI site.
1. Entries of the following format are from Genpept:
Note that this format has now been discontinued and all Genpept entries are now in the format described in section 2. Support for this format will be continued for a while for people who have an old copy of the database. The corresponding comment lines in the new format are given in section 2.
ProteinProspector programs designate:
- accession number, 304881, as all consecutive digits following the first "|"
- species, Escherichia coli, as the text string inside the last set of square brackets.
- name, (L07596) alaS , as the text string between the first space the last set of square brackets.
Whenever the species cannot be found the species is assigned as UNREADABLE, and the name is assigned as the entire comment line. All of these UNREADABLE lines are then written by FA-Index to the file seqdb/NCBInr....usp.
Lines which are too long are terminated by three full stops:
This line has a space at the end of the species:
The following entry has no species:
Here are some more examples. Note that what is in the species field isn't always a species.
2. Entries of the following format are from GenBank:
gb|accession|locus
ProteinProspector programs designate:
- accession number, 1680564, as all consecutive digits following the first "|"
- species, Pelargonium leaf curl virus, as the text string inside the last set of square brackets.
- name, (S58174) putative RNA polymerase, as the text string between the first space the last set of square brackets.
Here are some more examples.
Here are some example entries which have changed from format 1 to this format
3. Entries of the following format are from SWISS-PROT:
sp|accession|entry name
ProteinProspector programs designate:
- accession number, 132349, as all consecutive digits following the first "|"
- species, AGRTU, as the text string between the underscore and the next space when preceded by "sp|...|"
- name, REPLICATING PROTEIN, as the text string following the species.
Whenever the species cannot be found the species is assigned as UNREADABLE, and the name is assigned as the entire comment line. All of these UNREADABLE lines are then written by FA-Index to the file seqdb/NCBInr....usp.
Lines which are too long are terminated by three full stops:
A few entries are of the following form:
In these cases the species field is terminated in an underscore (VICVI for the example shown).
4. Entries of the following format are GNL Entries:
Here gnl stands for general and the next field, PIR in the above case, identifies the database.
gnl|database|identifier
ProteinProspector programs designate:
- accession number, 216351, as all consecutive digits following the first "|"
- species, Bacillus subtilis, as the text string inside the last set of square brackets.
- name, (D13793) ORF, as the text string between the first space the last set of square brackets.
5. Entries of the following format are from NBRF PIR:
pir||entry
ProteinProspector programs designate:
- accession number, 282349, as all consecutive digits following the first "|"
- species, Bacillus circulans, as the text string following the last space-dash-space (" - ") in the line.
- name, chitinase (EC 3.2.1.14) D, as the text string between the first space and the last dash " -" in the line.
Here are some more examples:
6. Entries of the following format are GenInfo Backbone Id Entries:
bbs|number
ProteinProspector programs designate:
- accession number, 3712669, as all consecutive digits following the first "|"
- species, Homo sapiens, as the text string inside the last set of square brackets.
- name, (S85224) vascular endothelial growth factor; VEGF 206, as the text string between the first space the last set of square brackets.
Sometimes the species field isn't present:
Sometimes it contains extra text apart from the species name:
Sometimes it appears twice:
Sometimes the species is recorded as unidentified:
Here are a couple of examples where the comment line has been truncated. In such cases it is terminated by three full stops:
7. Entries of the following format are from the Brookhaven Protein Data Bank:
pdb|entry|chain
ProteinProspector programs designate:
- accession number, 230275 in the first example, as all consecutive digits following the first "|"
- species, as UNREADABLE because it isn't reliably positioned within the comment line.
- name, as the entire comment line.
All the comment lines of this format are written by FA-Index to the file seqdb/NCBInr....usp.
8. Entries of the following format are from the Protein Research Foundation:
prf||name
ProteinProspector programs designate:
- accession number, 742246, as all consecutive digits following the first "|"
- species, Cellvibrio gilvus, as the text string inside the last set of square brackets.
- name, beta glucosidase, as the text string between the first space the last set of square brackets.
Here is another example.
9. Entries of the following format are from the DNA Database of Japan (DDBJ):
ProteinProspector programs designate:
- accession number, 2440229, as all consecutive digits following the first "|"
- species, Agrobacterium rhizogenes, as the text string inside the last set of square brackets.
- name, (AB006689) ORF13, as the text string between the first space the last set of square brackets.
dbj|accession|locus
Here is another example.
10. Entries of the following format are from the EMBL Data Library:
emb|accession|locus
ProteinProspector programs designate:
- accession number, 6, as all consecutive digits following the first "|"
- species, Bos taurus, as the text string inside the last set of square brackets.
- name, (X60065) beta-2-glycoprotein I, as the text string between the first space the last set of square brackets.
Sometimes the species field isn't present:
Here is an example where the comment line has been truncated. In such cases it is terminated by a > character:
11. Entries of the following format are NCBI Reference Sequences:
ref|accession|locus|:q
ProteinProspector programs designate:
- accession number, 5713315 as all consecutive digits following the first "|"
- species, as UNREADABLE because it isn't generally present in the comment line.
- name, as the entire comment line.
All the comment lines of this format are written by FA-Index to the file seqdb/NCBInr....usp.
This database wins the booby prize as the one with the least consistent comment lines.
Sample entry:
ProteinProspector programs designate:
- accession number, 1705383, as all consecutive digits following "gi|"
- species, Schistosoma mansoni; since this database is so haphazard in its placement of the species, FA-Index does a string search in the line after first consulting the file dbEST.spl.txt for valid species names. The string search method is possible with this particular database because there is a more limited range of species represented. However, this means that a server administrator needs to keep the dbEST.spl.txt file up to date to ensure continuous high quality species searching of dbEST with ProteinProspector programs. This task, though annoying, is made somewhat easier by consulting the seqdb/dbEST.usp file. Whenever the species cannot be found the species is assigned as UNREADABLE, and the name is assigned as the entire comment line. All of these UNREADABLE lines are then written by FA-Index to the file seqdb/dbEST.usp.
- name, N20717 SMNHADA002044SK SmAW Schistosoma mansoni cDNA 5', as the string following the first space.
Sometimes the comment lines are very long and appear to consist of two comment lines appended together. The two comment lines are separated by a non-printable binary character (ASCII code Control A) shown here as a full stop. In such cases Protein Prospector only considers the first part of the comment line.
This is another non-redundant database. The entries are of following format:
Here are some example - one from each of the components of the database:
ProteinProspector programs designate (example from first line above):
- accession number, M84711 as the text string between the first vertical bar and the next vertical bar.
- species, Homo sapiens as the text string inside the last set of square brackets.
- name, v-fos transformation effector protein, as the text string between the first space and the last set of square brackets.
Often the comment line in a FASTA database is used to describe basic information like entry name, accession number (or other unique identifier), and the species or organism from which the sequence was obtained. With well curated databases, this information is consistently organized into fields in the comment line of a FASTA formatted database.
For ProteinProspector programs the sequence field is only subject to 2 constraints. 1) it must be in CAPITAL lettters, and 2) it must be in single letter code (some people express amino acids in 3-letter code).
The way ProteinProspector programs "know" which dialect of FASTA to "speak" with a particular database's comment line is via the filename. Generic filename prefixes are shown below in bold and the associated comment line format described. These formats are handled in a relatively robust manner, to allow for the absence of fields or the presence of additional fields. The formats basically consist of "|" delimited fields of accession number, name, and species in that order.
The D forms designate that the sequence is DNA and will be translated into protein sequence by ProteinProspector programs. The P forms indicate protein sequence.
> 417909| Better than sliced bread growth factor beta|Mouse|pancreas|
ProteinProspector programs designate:
- accession number, 417909, as the integer before the first "|"
- name, Better than sliced bread growth factor beta, as the string between the first "|" and second "|" (or the end of the line, if no second "|")
- species, Mouse, as the string between the second "|" and third "|" (or the end of the line, if no third "|")
Whenever the species cannot be found the species is assigned as UNREADABLE, and the name is assigned as the entire comment line. All of these UNREADABLE lines are then written by FA-Index to the file seqdb/DN.usp, or seqdb/PN.usp.
The D forms designate that the sequence is DNA and will be translated into protein sequence by ProteinProspector programs. The P forms indicate protein sequence.
Note that the DA and PA differ from the DN and PN set only in that the accession number can be alphanumeric rather than numeric. This second set is thus more robust. However, for large, frequently updated databases FA-Index can take an hour to run rather than several minutes simply because creation of the dbfilename.acc file involves the much slower process of sorting strings rather than integers.
> SlowSort909| Better than sliced bread growth factor beta|Mouse|pancreas|
ProteinProspector programs designate:
- accession number, SlowSort909, as the alphanumeric string before the first "|"
- name, Better than sliced bread growth factor beta, as the string between the first "|" and second "|" (or the end of the line, if no second "|")
- species, Mouse, as the string between the second "|" and third "|" (or the end of the line, if no third "|")
Whenever the species cannot be found the species is assigned as UNREADABLE, and the name is assigned as the entire comment line. All of these UNREADABLE lines are then written by FA-Index to the file seqdb/DA.usp or seqdb/PA.usp.
Any number of proprietary databases may be created with DA, DN, PA or PN prefixes. You must also create species alias lists and accession number links for any databases which you create.
If these prefixes are used then all attempts at trying to extract information from the comment line are abandoned.
ProteinProspector programs designate:
- accession number, as the entry number (1 for the first entry, 2 for the second entry, etc).
- species, as UNREADABLE.
- name, as the entire comment line.
Ddefault is used for a database containing DNA sequences and Pdefault for one containing protein sequences.
| Suffix (databasefilename.xxx) |
Description |
|---|---|
| .idc | Contains a list of byte offsets for the start of the comment line for each entry in the database. |
| .idp | Contains a list of byte offsets for the start of the sequences for each entry in the database. |
| .idi | Contains the number of entries in the database, the length of the longest comment line in the database and the length of the longest sequence in the database. |
| .idx | Used in previous versions of Protein Prospector. Now obselete. |
| .unk | Index which keeps track of all foreign characters in the sequence field
for each database entry.
    For protein databases any characters other than the 20 standard amino acids are foreign characters.     For DNA databases any characters other than A, G, C, T, and N are foreign characters.     Note that the sequences must be in CAPITAL lettters, and in single letter code (some people express amino acids in 3-letter code). |
| .mw | Index containing the calculated protein Molecular Weight (MW) of each sequence in the database. For DNA sequences this MW is calculated by translating in frame 1 and ignoring stop codons. The amino acid C is treated as unmodified, the amino acid X is treated as L, the amino acid B is treated as E, the amino acid J is treated as Q. The .mw file is used to accelerate searches that are constrained by intact MW. |
| .pi | Index containing the calculated protein pI of each sequence in the database. For DNA sequences this pI is calculated by translating in frame 1 and ignoring stop codons. The amino acid C is treated as unmodified, the amino acid X is treated as L, the amino acid B is treated as E, the amino acid J is treated as Q. The .pi file is used to accelerate searches that are constrained by intact pI. |
| .sp | Index containing the Species of each sequence in the database. Used to accelerate searches that are constrained by species. |
| .sl | Contains a list in alphabetical order of the text strings used to denote different species. A text string has to occur at least ten times to appear in this file. This file is never used by the ProteinProspector programs. The text strings are the ones you should use in MS-Pattern if you have the Search Mode set to Species. |
| .usp | File created to list the comment lines of each entry for which FA-Index cannot read the species. This file is never used by the ProteinProspector programs; it is created only for use by server administrators in troubleshooting species problems. |
| .acc | Index of alphanumeric accession numbers, created only for database filename prefixes: Genpept, gen, SwissProt, swp, Owl, owl, DA, PA. |
| .acn | Index of integer accession numbers, created only for database filename prefixes: NCBInr, nr, dbEST, dbest, DN, PN. |
| Suffix (databasefilename.xxx) |
Bypassable | How to by-pass if possible |
|---|---|---|
| .idc | no | Necessary for any ProteinProspector program that searches/consults a database file. |
| .idp | no | Necessary for any ProteinProspector program that searches/consults a database file. |
| .idi | no | Necessary for any ProteinProspector program that searches/consults a database file. |
| .idx | n/a | Obselete |
| .unk | no | Necessary for any ProteinProspector program that searches/consults a database file. |
| .mw | yes | Select All in the MW search parameters. |
| .pi | yes | Select All in the pI search parameters. |
| .sp | yes | Select All in the Species search parameters. |
| .sl | yes | This file is never used by the ProteinProspector programs; it is used to report the contents of the species fields in the database file. |
| .usp | yes | This file is never used by the ProteinProspector programs; it is created only for use by server administrators in troubleshooting species problems. |
| .acc .acn |
yes | Don't choose retrieve by Accession number in MS-Digest, or set the search mode to Accession number in MS-Pattern. |
Once you've downloaded a new database into the seqdb directory you need to create the index files described above before you can start to use it. To do this:
1). Type the name of the database into the Newly Downloaded Database field.
2). Press the Create Indicies For New Database button.
The lists of databases and species used by the forms in the Protein Prospector package are held in Javascript files; the default location of these files is shown on the FA-Index form. To update the contents of the files press the Update Database and Species Lists in Forms button. After doing this you will probably have to reload the relevant HTML form before the new lists appear. If this doesn't work place the cursor in the URL location box of the browser and press return. If even this doesn't work investigate the cache settings on your browser.
The species Javascript file is generated from the information in the species.txt file.
The Javascript files are automatically updated after performing the following operations on the FA-Index form:
- Create Indicies For New Database
- Create a Pre-Search Subset Database
- Create Subset Database with Indices from Saved Hits
- Create or Append to User Database
You will still have to reload the form as described above to be able to select a newly created database.
ProteinProspector licensees can create their own subset databases which have been pre-filtered for species, species codes, molecular weight, pI and accession number. For example to create a subset database of human proteins between 1000-100000 Da from the SwissProt database:
1). Choose a suitable suffix for the database such as human.
2). Select SwissProt.rxx as the existing database.
3). Select HOMO SAPIENS as the species.
4). Enter 1000 to 100000 as the MW of the Protein and deselect All.
5). Press the Create Subset Database button.
Using subset databases is likely to dramatically decrease search times.
This feature is only available to ProteinProspector licensees.
The Hits (index numbers for matching database entries) from ProteinProspector search programs can be saved to a user-specified file. This file can then be used create a subset database containing only the Hit proteins from the search.
1). Choose a suitable suffix for the database. The suffix must be unique; if you use the same suffix twice then the previously created subset database will be overwritten.
2). Identify the database that was used in the original search.
3). Identify the file containing the saved hits by entering the Program and File Name.
4). Press the Create Subset Database with Indices from Saved Hits button.
This feature is only available to ProteinProspector licensees.
It is possible to create your own fasta format database which can be searched by the ProteinProspector search programs. An entry for a single protein or DNA sequence is made up of a comment line containing accession number, species and name fields followed by one or more lines containing the sequence.
1). Enter the database name. There are several dialects of fasta with the essential difference between them being the format of the comment line. You are strongly advised to use a proprietary format but it is also possible to use a public format. If you choose a database name that already exists on the disk then subsequent proteins will be appended to the end of the file, otherwise a new database file will be created. It is possible to append entries to the end of the publicly available databases but this is not advisable; firstly because the index files are remade after each entry, secondly because newer versions of the database won't contain your entries and thirdly because any errors in the information you supply when adding the entry could potentially damage the whole database. If you want to use a public database format you should use a database name such as NCBInr.user.
2). Enter a name for the entry. Whether you are using a proprietary format or a public format make sure you don't use characters in the name which might give the ProteinProspector programs problems in sorting out the fields in the comment line.
3). Enter a species for the entry. This should be consistent with the information in the species.txt file.
4). Enter an accession number for the entry. The accession number must be unique; the program will alert you if it isn't. If your database uses numeric accession numbers then the accession number must be numeric.
5). Enter the protein or DNA sequence using only the upper case symbols for the 20 naturally occurring amino acids or the four base pairs as appropriate. X may also be used to if the sequence is unknown at a particular point.
6). Press the Create or Append to User Database button.
The database summary report option is used to list the accession numbers, species and name fields for a selected index number range of a selected database. Deselect the Hide Protein Sequence checkbox if you also want to see the protein sequences. You can also select the DNA Reading Frame if you are looking at a DNA database.
FA-Index can also be run from the command line. You might want to do this if you want to set up a batch job to automatically update the databases or if running it from the web page interface causes a time out.
On all operating systems the FA-Index program is expected to reside in the same directory as all other ProteinProspector programs (i.e. ). The command line version of FA-Index can accept the same parameters as the web page version. The parameters are specified as name value pairs separated by spaces. A list of all the parameters is given in the Protein Prospector Automation Manual.
All the Protein Prospector programs can be similarly run from a command line interface. See the Protein Prospector Automation Manual for details.
On UNIX systems issue a command from the directory of the form:
On Windows NT/2000 systems use an MS-DOS command prompt to issue a command of the form:
You may first need to type:
path=C:\http\
Alternatively you could try: